PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.J01929.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 424aa    MW: 46542.5 Da    PI: 8.056
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.J01929.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.74.9e-12114151139
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkq 39 
                       +g WT+eEd +lv +vkq+G + W+ Ia+++  gR +k+
  Eucgr.J01929.1.p 114 KGQWTEEEDRKLVSLVKQYGVRKWAQIAEKLA-GRAGKH 151
                       799****************************9.*99987 PP

2Myb_DNA-binding54.62.5e-17151191345
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        W++eE+ +lv+a+++ G++ W+ Ia++++ gRt++ +k++w+
  Eucgr.J01929.1.p 151 HWSEEEERILVEAHEEVGNR-WAEIAKRIP-GRTENAIKNHWN 191
                       6*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-12111150IPR009057Homeodomain-like
SuperFamilySSF466895.03E-21112190IPR009057Homeodomain-like
SMARTSM007170.15113147IPR001005SANT/Myb domain
PfamPF139216.3E-7117148No hitNo description
PROSITE profilePS5129420.683144198IPR017930Myb domain
SMARTSM007171.9E-16148196IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.7E-18151192IPR009057Homeodomain-like
PfamPF002498.5E-16151191IPR001005SANT/Myb domain
CDDcd001677.26E-14152194No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MEGAGDEPSL NRPCLPLKAL ESFLWSQAHI SDHQASCHES TKRTEENSTP FGNASFADGL  60
IVDAGSSGNN WVVVNEPNPR EGARDDRVVK VMGKSKKLAT GKRVKRGSHA TLIKGQWTEE  120
EDRKLVSLVK QYGVRKWAQI AEKLAGRAGK HWSEEEERIL VEAHEEVGNR WAEIAKRIPG  180
RTENAIKNHW NATKRRQNSR RTKLGLHGGQ HHNPTQSSGK NSNNNNNNKP HSSVLEDYIR  240
SKNLHNAAVT TEAQAKKAGP GPTECNDPPK QPFHFFLPEL SETYDDEVRF MQKFFPASNY  300
GDSRLQLGDV TGKDGLIERP NAVVHTDNVI EVAGNQASPA TNTKSLLMNN PDLYLSSLLN  360
GVDYHSSCSS SNSLGYHPGY GYGYGYNGAS GGTAVANDQA LTPYGGREMD LIEMVSSSQR  420
TNL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-291121975107B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.J01929.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010034582.10.0PREDICTED: myb-related protein A
TrEMBLA0A059AFM80.0A0A059AFM8_EUCGR; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42652656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.14e-48myb domain protein 119